PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010683m
Common NameEUTSA_v10010683mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 27229.7 Da    PI: 8.2653
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010683mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.88.2e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+e++s
  Thhalv10010683m  9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFIS 59
                     79***********************************************86 PP

2K-box81.22.5e-2771169199
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                      yq+ s+++++++++e++q+  +kL + ++nL+++++++lGe+L++L+++eL++Le+++e+  k +R++K + l +qie+++kk+k++q+++k+L
  Thhalv10010683m  71 YQTVSDVDVWSTHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDVEELRSLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNL 164
                      78899999************************************************************************************** PP

            K-box  95 rkkle 99 
                       ++le
  Thhalv10010683m 165 IHELE 169
                      99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.226161IPR002100Transcription factor, MADS-box
CDDcd002652.13E-40280No hitNo description
PRINTSPR004048.0E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-36394IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-293859IPR002100Transcription factor, MADS-box
PfamPF014864.4E-1682168IPR002487Transcription factor, K-box
PROSITE profilePS5129713.94484174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEFISP  60
NTTTKEIIDL YQTVSDVDVW STHYERMQET KRKLLETNRN LRTQIKQRLG ECLDELDVEE  120
LRSLEDEMEN TFKLVRERKF KSLGNQIETT KKKNKSQQDI QKNLIHELEL RAEDPHYGLV  180
DNGGDYDSVL GYQIEGSRAY ALRFHQNHHH HYPNHALHAA SASDIITFHL LE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-17161161Myocyte-specific enhancer factor 2B
1tqe_R2e-17161161Myocyte-specific enhancer factor 2B
1tqe_Q2e-17161161Myocyte-specific enhancer factor 2B
1tqe_P2e-17161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0703970.0AY070397.1 Arabidopsis thaliana putative floral homeotic protein APETALA3 (AP3) (At3g54340) mRNA, complete cds.
GenBankAY1425900.0AY142590.1 Arabidopsis thaliana putative floral homeotic protein APETALA3 (AP3) (At3g54340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403587.11e-174hypothetical protein EUTSA_v10010683mg
SwissprotP356321e-169AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBLV4L4041e-174V4L404_EUTSA; Uncharacterized protein
STRINGBra007067.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52612750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-155MIKC_MADS family protein